ABCE1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036846

 

Antibody CAB012476

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA036846 32270 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

88  

Antigen sequence

KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFAC
AVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP
 
 

Matching transcripts

ABCE1-001 - ENSP00000296577 [100%]
ABCE1-010 - ENSP00000422068 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:300 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.3, 47.0 67.3, 47.0, 23.4, 16.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:105  

Validation IF

Supportive: The subcellular location is supported by literature.  

         siRNA

Image

  

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. 

Antibody dilution

1:105  

Validation siRNA

Supportive: The siRNA validation is supportive.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ABCE1-001
 
ABCE1-010