USP49

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030254

 

Antibody HPA030255

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030254 HPA030255 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

78 75 

Antigen sequence

GQKQDTPVRRGRTLRSMASGEDVVLPQRAPQGQPQMLTALWYRRQRLLAR
TLRLWFEKSSRGQAKLEQRRQEEALERK
 
ECFLNLDPSKTEHLFPKATNGKTQLSGKPTNSSATELSLRNDRAEACERE
GFCWNGRASISRSLELIQNKEPSSK
 

Matching transcripts

USP49-001 - ENSP00000362097 [100%]
USP49-002 - ENSP00000362101 [100%]
USP49-007 - ENSP00000377797 [100%]
USP49-201 - ENSP00000297229 [100%]
USP49-202 - ENSP00000362100 [100%]
 USP49-001 - ENSP00000362097 [100%]
USP49-002 - ENSP00000362101 [100%]
USP49-007 - ENSP00000377797 [100%]
USP49-201 - ENSP00000297229 [100%]
USP49-202 - ENSP00000362100 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in subsets of cells in the red pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:140 1:55 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412999)
More information
 

Target mass (kDa)

79.2, 73.5, 67.5 79.2, 73.5, 67.5 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
USP49-001
 
USP49-002
 
USP49-007
 
USP49-201
 
USP49-202