AQP7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044049

 

Antibody HPA048106

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044049 HPA048106 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

26 37 

Antigen sequence

ASGHRRSTRGSKMVSWSVIAKIQEIC
 
IGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPMIS
 

Matching transcripts

AQP7-006 - ENSP00000297988 [96%]
AQP7-203 - ENSP00000439534 [96%]
AQP7-001 - ENSP00000368821 [85%]
AQP7-003 - ENSP00000368820 [85%]
 AQP7-001 - ENSP00000368821 [97%]
AQP7-006 - ENSP00000297988 [97%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells.
More information
 Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:15 

Literature conformity

Not consistent with gene/protein characterization data Not consistent with gene/protein characterization data 

RNA consistency

Not at all consistent with RNAseq data Not at all consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

37.2, 37.0, 28.1, 27.9 37.2, 37.0 

Antibody dilution

1:250 1:120 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:950 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AQP7-001
 
AQP7-003
 
AQP7-006
 
AQP7-203