PRKCB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048321

 

Antibody CAB003843

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA048321 1514-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

13 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

65  

Antigen sequence

EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQN
EFAGFSYTNPEFVIN
 
 

Matching transcripts

PRKCB-001 - ENSP00000318315 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows weak nuclear positivity in exocrine glandular cells and weak cytoplasmic in islets of Langerhans.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:100 

Literature conformity

Partly consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.9 77.0, 76.9, 14.9, 14.0, 13.8, 6.4 

Antibody dilution

1:170 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PRKCB-001