AP1G1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041224

 

Antibody CAB009049

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA041224 sc-10763 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

14 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

93  

Antigen sequence

FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITI
QASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI
 
 

Matching transcripts

AP1G1-001 - ENSP00000299980 [100%]
AP1G1-002 - ENSP00000454523 [100%]
AP1G1-008 - ENSP00000454219 [100%]
AP1G1-014 - ENSP00000377148 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:28  

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  

         siRNA

Image

  

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. 

Antibody dilution

1:28  

Validation siRNA

Supportive: The siRNA validation is supportive.  

         Western blot - siRNA

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: siRNA 1
Lane 3: siRNA 2
Lane 4: Scrambled
More information
 Application not done for this antibody. 

Target mass (kDa)

91.7, 91.4, 26.3  

Loading control

Total protein image  

Antibody dilution

1:61  

Validation WB-siRNA

Supportive: Downregulation visible in both siRNA lanes  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

91.7, 91.4, 26.3 91.7, 91.4, 26.3, 21.4, 16.6, 16.0, 10.8, 10.0, 6.3, 3.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AP1G1-001
 
AP1G1-002
 
AP1G1-008
 
AP1G1-014