IGF2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007993

 

Antibody CAB024999

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA007993 MAB2921 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

126  

Antigen sequence

TLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAK
SERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRG
HVLAKELEAFREAKRHRPLIALPTQD
 
 

Matching transcripts

IGF2-001 - ENSP00000414497 [100%]
IGF2-003 - ENSP00000370802 [100%]
IGF2-005 - ENSP00000402047 [100%]
IGF2-007 - ENSP00000391826 [100%]
IGF2-009 - ENSP00000370796 [100%]
IGF2-014 - ENSP00000338297 [100%]
IGF2-201 - ENSP00000300632 [100%]
IGF2-002 - ENSP00000370813 [97%]
IGF2-004 - ENSP00000370799 [97%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
More information
 Immunohistochemical staining of human placenta shows strong positivity in trophoblastic cells and endothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:600 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422803)
More information
  

Target mass (kDa)

26.3, 20.5, 20.1 26.3, 20.5, 20.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 

Antibody dilution

 1:150 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
IGF2-001
 
IGF2-002
 
IGF2-003
 
IGF2-004
 
IGF2-005
 
IGF2-007
 
IGF2-009
 
IGF2-014
 
IGF2-201