YIF1B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055257

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA055257 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

73 

Antigen sequence

HQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYG
SSLAAQGKELVDKNIDRFIPITK
 

Matching transcripts

YIF1B-001 - ENSP00000343435 [100%]
YIF1B-002 - ENSP00000337411 [100%]
YIF1B-003 - ENSP00000465446 [100%]
YIF1B-004 - ENSP00000466428 [100%]
YIF1B-006 - ENSP00000375971 [100%]
YIF1B-007 - ENSP00000468358 [100%]
YIF1B-008 - ENSP00000465277 [100%]
YIF1B-010 - ENSP00000329559 [100%]
YIF1B-011 - ENSP00000465230 [100%]
YIF1B-012 - ENSP00000468463 [100%]
YIF1B-015 - ENSP00000467489 [88%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

34.4, 32.8, 31.6, 31.2, 26.9, 25.2, 21.0, 11.2 

Antibody dilution

1:490 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3900 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
YIF1B-001
 
YIF1B-002
 
YIF1B-003
 
YIF1B-004
 
YIF1B-006
 
YIF1B-007
 
YIF1B-008
 
YIF1B-010
 
YIF1B-011
 
YIF1B-012
 
YIF1B-015
 
 »