KLK6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051837

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051837 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

89 

Antigen sequence

RQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPL
ERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSRE
 

Matching transcripts

KLK6-001 - ENSP00000309148 [100%]
KLK6-003 - ENSP00000366047 [100%]
KLK6-006 - ENSP00000470482 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:6 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

26.9 

Antibody dilution

1:80 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KLK6-001
 
KLK6-003
 
KLK6-006