PKIG

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042703

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042703 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

52 

Antigen sequence

DIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTT
SS
 

Matching transcripts

PKIG-001 - ENSP00000361985 [100%]
PKIG-002 - ENSP00000361983 [100%]
PKIG-003 - ENSP00000361981 [100%]
PKIG-004 - ENSP00000361977 [100%]
PKIG-006 - ENSP00000361980 [100%]
PKIG-008 - ENSP00000338067 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:60 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:41 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Target too small/large to be analyzed with the present setup 

Target mass (kDa)

7.9 

Antibody dilution

 

Validation WB

 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PKIG-001
 
PKIG-002
 
PKIG-003
 
PKIG-004
 
PKIG-006
 
PKIG-008