ZBTB49

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024450

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA024450 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

109 

Antigen sequence

AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNI
QVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDA
TCVISENYP
 

Matching transcripts

ZBTB49-001 - ENSP00000338807 [100%]
ZBTB49-006 - ENSP00000422321 [100%]
ZBTB49-201 - ENSP00000348091 [100%]
ZBTB49-004 - ENSP00000425747 [94%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:400 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Not at all consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.1, 71.2, 50.4, 16.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ZBTB49-001
 
ZBTB49-004
 
ZBTB49-006
 
ZBTB49-201