KLK7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018994

 

Antibody CAB026342

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA018994 3352.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

86  

Antigen sequence

MVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDC
TKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCR
 
 

Matching transcripts

KLK7-001 - ENSP00000470538 [100%]
KLK7-003 - ENSP00000469950 [100%]
KLK7-201 - ENSP00000337540 [100%]
KLK7-202 - ENSP00000375683 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic and nuclear positivity in a subset of bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:375 1:600 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417538)
More information
  

Target mass (kDa)

27.5, 19.9, 15.2 27.5, 19.9, 15.2, 7.8, 7.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
KLK7-001
 
KLK7-003
 
KLK7-201
 
KLK7-202