B3GALNT1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041204

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041204 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

57 

Antigen sequence

HYNVIERVNWMYFYEYEPIYRQDFHFTLREHSNCSHQNPFLVILVTSHPS
DVKARQA
 

Matching transcripts

B3GALNT1-001 - ENSP00000376530 [100%]
B3GALNT1-002 - ENSP00000323479 [100%]
B3GALNT1-003 - ENSP00000376532 [100%]
B3GALNT1-004 - ENSP00000420163 [100%]
B3GALNT1-005 - ENSP00000418226 [100%]
B3GALNT1-013 - ENSP00000419476 [100%]
B3GALNT1-201 - ENSP00000376531 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in paneth cells and positivity in plasma.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:40 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.5, 13.5 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
B3GALNT1-001
 
B3GALNT1-002
 
B3GALNT1-003
 
B3GALNT1-004
 
B3GALNT1-005
 
B3GALNT1-013
 
B3GALNT1-201