SIN3A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047213

 

Antibody HPA062123

 

Antibody CAB004506

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA047213 HPA062123 sc-5299 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

116 95  

Antigen sequence

SDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQR
GREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYR
RTALLRAHQSHERVSK
 
LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGI
QYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV
 
 

Matching transcripts

SIN3A-001 - ENSP00000378402 [100%]
SIN3A-002 - ENSP00000353622 [100%]
SIN3A-004 - ENSP00000378403 [100%]
 SIN3A-001 - ENSP00000378402 [100%]
SIN3A-002 - ENSP00000353622 [100%]
SIN3A-003 - ENSP00000455834 [100%]
SIN3A-004 - ENSP00000378403 [100%]
SIN3A-005 - ENSP00000455204 [100%]
SIN3A-006 - ENSP00000455662 [100%]
SIN3A-007 - ENSP00000455072 [100%]
SIN3A-014 - ENSP00000454750 [100%]
SIN3A-015 - ENSP00000455644 [100%]
SIN3A-013 - ENSP00000456997 [99%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows nuclear positivity in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
More information
 Immunohistochemical staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:500 1:10 1:20 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line HeLa shows positivity in cytoplasm, cytokinetic bridge & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line SiHa shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:75 1:21 1:5 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

145.2 145.2, 19.3, 17.1, 15.4, 14.0, 13.2, 11.4, 10.5 145.2, 19.3, 17.1, 15.4, 14.0, 13.2, 11.4, 10.5, 2.2 

Antibody dilution

1:380 1:80 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:550  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         siRNA

Image

   

Description

Application not done for this antibody. Signal downregulation > 25% by one siRNA.
More information
 Application not done for this antibody. 

Antibody dilution

 1:21  

Validation siRNA

 Supportive: The siRNA validation is supportive.  
 

ANTIGEN VIEW

? »
 
 
 
SIN3A-001
 
SIN3A-002
 
SIN3A-003
 
SIN3A-004
 
SIN3A-005
 
SIN3A-006
 
SIN3A-007
 
SIN3A-013
 
SIN3A-014
 
SIN3A-015