PTK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001842

 

Antibody CAB004036

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA001842 3285 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

145  

Antigen sequence

PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPE
PLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPK
LANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
 
 

Matching transcripts

PTK2-001 - ENSP00000429911 [100%]
PTK2-003 - ENSP00000429023 [100%]
PTK2-007 - ENSP00000429129 [100%]
PTK2-008 - ENSP00000429082 [100%]
PTK2-010 - ENSP00000429929 [100%]
PTK2-011 - ENSP00000341189 [100%]
PTK2-057 - ENSP00000429474 [100%]
PTK2-201 - ENSP00000378644 [100%]
PTK2-202 - ENSP00000438009 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.
More information
 Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:10 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Testis
More information
 

Target mass (kDa)

124.1, 120.9, 120.8, 119.2, 115.4, 114.3, 35.8 124.1, 120.9, 120.8, 119.2, 115.4, 114.3, 84.8, 81.5, 81.0, 76.8, 40.2, 35.8, 19.3, 18.2, 15.0, 14.8, 14.3, 14.0, 13.8, 13.7, 13.5, 13.2, 12.9, 12.0, 9.2, 8.4, 8.0, 7.6, 7.3, 7.2, 5.6, 1.5, 0.9 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PTK2-001
 
PTK2-003
 
PTK2-007
 
PTK2-008
 
PTK2-010
 
PTK2-011
 
PTK2-057
 
PTK2-201
 
PTK2-202