SCN9A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA061843

 

Antibody CAB013679

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA061843 2056.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

14 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

46  

Antigen sequence

RAYRRYRLRQNVKNISSIYIKDGDRDDDLLNKKDMAFDNVNENSSP
 
 

Matching transcripts

SCN9A-001 - ENSP00000386306 [100%]
SCN9A-004 - ENSP00000386330 [100%]
SCN9A-201 - ENSP00000304748 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:900 

Literature conformity

 Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line BJ shows positivity in plasma membrane & actin filaments.
More information
 Application not done for this antibody. 

Antibody dilution

1:60  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

  

Description

  

Target mass (kDa)

226.4, 225.2 226.4, 225.2, 61.1, 60.0 

Antibody dilution

1:200 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2400  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SCN9A-001
 
SCN9A-004
 
SCN9A-201