APLF

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034642

 

Antibody HPA034643

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA034642 HPA034643 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

84 77 

Antigen sequence

SQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAE
HLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLN
 
NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPEC
PYGPSCYRKNPQHKIEYRHNTLPVRNV
 

Matching transcripts

APLF-001 - ENSP00000307004 [100%]
APLF-004 - ENSP00000393403 [100%]
 APLF-001 - ENSP00000307004 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.
More information
 Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes and bile duct cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:40 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:75  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.0, 30.7 57.0 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
APLF-001
 
APLF-004