APLF

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029396

 

Antibody HPA034642

 

Antibody HPA034643

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029396 HPA034642 HPA034643 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 13 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

54 84 77 

Antigen sequence

GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNS
RTFF
 
SQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAE
HLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLN
 
NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPEC
PYGPSCYRKNPQHKIEYRHNTLPVRNV
 

Matching transcripts

APLF-201 - ENSP00000377874 [100%]
 APLF-001 - ENSP00000307004 [100%]
 APLF-001 - ENSP00000307004 [100%]
 

Other gene match

PROKR1 - ENSG00000169618 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human esophagus shows nuclear positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes and bile duct cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:60 1:500 1:40 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

 1:75  

Validation IF

 Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403372)
More information
  Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

44.8 57.0 57.0 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
APLF-001
 
APLF-201