CHD3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043368

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043368 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

73 

Antigen sequence

LKIKLGLLGGKREKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGP
VRTKKLKRGRPGRKKKKLLGCPA
 

Matching transcripts

CHD3-001 - ENSP00000332628 [97%]
CHD3-002 - ENSP00000350907 [97%]
CHD3-003 - ENSP00000369716 [97%]
CHD3-006 - ENSP00000405861 [92%]
CHD3-015 - ENSP00000458861 [92%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows distinct nuclear positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:800 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus, nucleoli & intermediate filaments.
More information
 

Antibody dilution

1:167 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

233.0, 226.6, 222.9, 58.8, 11.9 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CHD3-001
 
CHD3-002
 
CHD3-003
 
CHD3-006
 
CHD3-015