ARL6IP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045307

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045307 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

41 

Antigen sequence

FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
 

Matching transcripts

ARL6IP1-001 - ENSP00000306788 [100%]
ARL6IP1-002 - ENSP00000440048 [100%]
ARL6IP1-006 - ENSP00000455341 [100%]
 

Other gene match

RP11-1035H13.3 - ENSG00000260342 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414753)
More information
 

Target mass (kDa)

27.2, 23.4, 20.3, 12.0 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARL6IP1-001
 
ARL6IP1-002
 
ARL6IP1-006