CDH2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA058574

 

Antibody CAB000141

 

Antibody CAB018580

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 Santa Cruz Biotechnology
 

Product name

HPA058574 18-0224 sc-8424 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

13 1 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Not known 

Length (aa)

87   

Antigen sequence

NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVT
VIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
 
 
 

Matching transcripts

CDH2-001 - ENSP00000269141 [100%]
CDH2-003 - ENSP00000382312 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human heart muscle shows distinct positivity in intercalated disc.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.
More information
 Immunohistochemical staining of human heart muscle shows strong membranous positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:20 1:150 1:40 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Not done Not done 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cell junctions.
More information
 Application not done for this antibody. 

Antibody dilution

 1:154  

Validation IF

 Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

99.8, 97.0 99.8, 97.0, 21.9, 13.8, 8.5 99.8, 97.0, 21.9, 13.8, 8.5 

Antibody dilution

1:80 1:500 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:650   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CDH2-001
 
CDH2-003