RXFP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027067

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027067 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

69 

Antigen sequence

PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPD
LFTYPCEMSLISQSTRLNS
 

Matching transcripts

RXFP1-001 - ENSP00000423306 [100%]
RXFP1-002 - ENSP00000303248 [100%]
RXFP1-005 - ENSP00000345889 [100%]
RXFP1-006 - ENSP00000420712 [100%]
RXFP1-201 - ENSP00000405841 [100%]
RXFP1-202 - ENSP00000414885 [100%]
RXFP1-203 - ENSP00000480522 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human oral mucosa shows moderate cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

90.1, 87.0, 83.1, 81.5, 78.0, 72.7, 69.5 

Antibody dilution

1:250 

Validation WB

Current setup is not applicable due to low RNA count 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RXFP1-001
 
RXFP1-002
 
RXFP1-005
 
RXFP1-006
 
RXFP1-201
 
RXFP1-202
 
RXFP1-203