BCL2L1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035734

 

Antibody CAB000105

 

Antibody CAB072801

 

Antibody CAB072802

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 NCI-CPTC
 NCI-CPTC
 

Product name

HPA035734 MAB4625 CPTC-BCL2L1-2 CPTC-BCL2L1-3 

Host species

Rabbit Mouse Mouse Mouse 

Clonality

pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G Protein A/G 

Released in version

13 1 14 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein Recombinant protein 

Length (aa)

70    

Antigen sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
INGNPSWHLADSPAVNGATG
 
 
 
 

Matching transcripts

BCL2L1-001 - ENSP00000365230 [100%]
BCL2L1-002 - ENSP00000365223 [100%]
BCL2L1-003 - ENSP00000406203 [100%]
BCL2L1-004 - ENSP00000302564 [100%]
BCL2L1-005 - ENSP00000389688 [100%]
BCL2L1-006 - ENSP00000390760 [100%]
BCL2L1-007 - ENSP00000395545 [100%]
BCL2L1-008 - ENSP00000411252 [100%]
    

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
More information
 Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in granular pattern in bone marrow poietic cells.
More information
 Application not done for this antibody. Application not done for this antibody. 

Retrieval method

HIER pH6 HIER pH9   

Antibody dilution

1:650 1:100   

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data   

RNA consistency

Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data   

         Immunofluorescence

Image

    

Description

Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line MCF7 shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria & vesicles.
More information
 

Antibody dilution

  1:37 1:25 

Validation IF

  Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Application not done for this antibody. Application not done for this antibody. 

Target mass (kDa)

26.0, 22.9, 21.0, 20.2, 18.9 26.0, 22.9, 21.0, 20.2, 18.9, 5.5   

Antibody dilution

1:250 1:500   

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%)   

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
BCL2L1-001
 
BCL2L1-002
 
BCL2L1-003
 
BCL2L1-004
 
BCL2L1-005
 
BCL2L1-006
 
BCL2L1-007
 
BCL2L1-008