BCL2L1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035734

 

Antibody CAB000105

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA035734 MAB4625 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

70  

Antigen sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
INGNPSWHLADSPAVNGATG
 
 

Matching transcripts

BCL2L1-001 - ENSP00000365230 [100%]
BCL2L1-002 - ENSP00000365223 [100%]
BCL2L1-003 - ENSP00000406203 [100%]
BCL2L1-004 - ENSP00000302564 [100%]
BCL2L1-005 - ENSP00000389688 [100%]
BCL2L1-006 - ENSP00000390760 [100%]
BCL2L1-007 - ENSP00000395545 [100%]
BCL2L1-008 - ENSP00000411252 [100%]
BCL2L1-201 - ENSP00000405563 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
More information
 Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in granular pattern in bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:650 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

26.0, 22.9, 21.0, 20.2, 18.9 26.0, 22.9, 21.0, 20.2, 18.9, 5.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A549 shows positivity in nucleus, nucleoli & mitochondria.
More information
 Application not done for this antibody. 

Antibody dilution

1:51  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BCL2L1-001
 
BCL2L1-002
 
BCL2L1-003
 
BCL2L1-004
 
BCL2L1-005
 
BCL2L1-006
 
BCL2L1-007
 
BCL2L1-008
 
BCL2L1-201