ADRBK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048330

 

Antibody CAB005021

 

Antibody CAB037248

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 SIGMA
 

Product name

HPA048330 1516-1 G0296 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb mAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant Affinity 

Released in version

12 11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein Synthetic peptide 

Length (aa)

50   

Antigen sequence

LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
 
 
 

Matching transcripts

ADRBK1-001 - ENSP00000312262 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human lymph node shows distinct cytoplasmic positivity in reaction center cells.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:50 1:4000 

Validation IH

 Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

79.6 79.6, 46.5 79.6, 46.5 

Antibody dilution

1:160 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
   

Antibody dilution

1:32   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
ADRBK1-001