GPR113

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044500

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044500 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

112 

Antigen sequence

CIPSTNLAYTAAWSPGEGSKASSFNESGSQCFVLAVQRCPMADTTYACDL
QSLGLAPLRVPISITIIQDGDITCPEDASVLTWNVTKAGHVAQAPCPESK
RGIVRRLCGADG
 

Matching transcripts

GPR113-001 - ENSP00000404775 [100%]
GPR113-004 - ENSP00000307831 [100%]
GPR113-006 - ENSP00000388537 [100%]
GPR113-009 - ENSP00000327396 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows distinct cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Literature conformity

No avaliable characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

116.3, 107.0, 93.9 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GPR113-001
 
GPR113-004
 
GPR113-006
 
GPR113-009