CD7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039079

 

Antibody CAB002594

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA039079 MS-1076 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

66  

Antigen sequence

YTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSAL
PDPQTASALPDPPAAS
 
 

Matching transcripts

CD7-001 - ENSP00000312027 [100%]
CD7-002 - ENSP00000463612 [100%]
CD7-003 - ENSP00000463489 [100%]
CD7-006 - ENSP00000464565 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in subset of cells in germinal and non-germinal center cells.
More information
 Immunohistochemical staining of human duodenum shows distinct positivity in inflammatory cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:20 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

25.4, 23.0, 14.8, 12.4 25.4, 23.0, 17.2, 14.8, 12.4, 3.4 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD7-001
 
CD7-002
 
CD7-003
 
CD7-006