EMR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052809

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052809 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

76 

Antigen sequence

MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGG
RWTSFGCVILEASETYTICSCNQMAN
 

Matching transcripts

EMR1-001 - ENSP00000250572 [100%]
EMR1-002 - ENSP00000311545 [100%]
EMR1-003 - ENSP00000370814 [100%]
EMR1-004 - ENSP00000370811 [100%]
EMR1-005 - ENSP00000405974 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human bronchus shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:200 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

97.7, 95.9, 90.4, 82.8, 78.9 

Antibody dilution

1:210 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1700 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
EMR1-001
 
EMR1-002
 
EMR1-003
 
EMR1-004
 
EMR1-005