ALG10B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043329

 

Antibody HPA063387

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043329 HPA063387 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

39 24 

Antigen sequence

SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP
 
AHKYLLADNRHYTFYVWKRVFQRY
 

Matching transcripts

ALG10B-001 - ENSP00000310120 [100%]
ALG10B-003 - ENSP00000448819 [100%]
 ALG10B-001 - ENSP00000310120 [100%]
 

Other gene match

ALG10 - ENSG00000139133 [100%]
 ALG10 - ENSG00000139133 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:75  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line SiHa shows positivity in endoplasmic reticulum.
More information
 

Antibody dilution

 1:27 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

55.6, 55.4, 14.6 55.6, 55.4 

Antibody dilution

1:250 1:90 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:950 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ALG10B-001
 
ALG10B-003