BDNF

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA056104

 

Antibody CAB009564

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA056104 sc-20981 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

130  

Antigen sequence

PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEE
LLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDA
ANMSMRVRRHSDPARRGELSVCDSISEWVT
 
 

Matching transcripts

BDNF-001 - ENSP00000432035 [100%]
BDNF-002 - ENSP00000379305 [100%]
BDNF-003 - ENSP00000379302 [100%]
BDNF-004 - ENSP00000435805 [100%]
BDNF-007 - ENSP00000379307 [100%]
BDNF-008 - ENSP00000414303 [100%]
BDNF-009 - ENSP00000435564 [100%]
BDNF-010 - ENSP00000349084 [100%]
BDNF-011 - ENSP00000400502 [100%]
BDNF-012 - ENSP00000432376 [100%]
BDNF-013 - ENSP00000379309 [100%]
BDNF-014 - ENSP00000432727 [100%]
BDNF-015 - ENSP00000389345 [100%]
BDNF-016 - ENSP00000437138 [100%]
BDNF-018 - ENSP00000320002 [100%]
BDNF-201 - ENSP00000379304 [100%]
BDNF-202 - ENSP00000389564 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:50 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

37.1, 29.8, 28.9, 27.8 37.1, 29.8, 28.9, 27.8, 8.6 

Antibody dilution

1:170 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-549 shows positivity in nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:33  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
BDNF-001
 
BDNF-002
 
BDNF-003
 
BDNF-004
 
BDNF-007
 
BDNF-008
 
BDNF-009
 
BDNF-010
 
BDNF-011
 
BDNF-012
 
BDNF-013
 
BDNF-014
 
BDNF-015
 
BDNF-016
 
BDNF-018
 
BDNF-201
 
BDNF-202
 
 »