LCORL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028794

 

Antibody HPA028795

 

Antibody HPA060033

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028794 HPA028795 HPA060033 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

93 96 87 

Antigen sequence

GPSIVCKSIQMNQAENSLQEEQEGPLDLTVNRMQEQNTQQGDGVLDLSTK
KTSIKSEESSICDPSSENSVAGRLHRNREDYVERSAEFADGLL
 
TYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVSSVSKSQPDG
SGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSV
 
DCIPSLDSSQSTPTEELSSQGQSNTDKIECQAENYLNALFRKKDLPQNCD
PNIPLVAQELMKKMIRQFAIEYISKSGKTQENRNGSI
 

Matching transcripts

LCORL-002 - ENSP00000371659 [100%]
LCORL-201 - ENSP00000371661 [100%]
LCORL-001 - ENSP00000317566 [81%]
 LCORL-002 - ENSP00000371659 [100%]
LCORL-201 - ENSP00000371661 [100%]
 LCORL-001 - ENSP00000317566 [100%]
LCORL-002 - ENSP00000371659 [100%]
LCORL-201 - ENSP00000371661 [100%]
LCORL-202 - ENSP00000444394 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:100 1:15  

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done Not done  

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:50  1:35 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.0, 57.5, 35.4 67.0, 57.5 67.0, 57.5, 35.4, 16.3 

Antibody dilution

1:250 1:250 1:120 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:1300 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LCORL-001
 
LCORL-002
 
LCORL-201
 
LCORL-202