AURKB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037708

 

Antibody CAB005862

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA037708 ab3609 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

14 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

66  

Antigen sequence

WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVME
NSSGTPDILTRHFTID
 
 

Matching transcripts

AURKB-001 - ENSP00000463999 [100%]
AURKB-005 - ENSP00000462207 [100%]
AURKB-008 - ENSP00000462930 [100%]
AURKB-002 - ENSP00000313950 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human tonsil shows strong nuclear positivity in subset of non-germinal center cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:35 

Literature conformity

 Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytokinetic bridge & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:52  

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.5, 39.3, 35.3, 26.2 39.5, 39.3, 35.3, 34.8, 28.0, 26.8, 26.2, 20.0, 7.8 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AURKB-001
 
AURKB-002
 
AURKB-005
 
AURKB-008