CLK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046817

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046817 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

52 

Antigen sequence

RHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDD
KE
 

Matching transcripts

CLK3-001 - ENSP00000344112 [100%]
CLK3-003 - ENSP00000378505 [100%]
CLK3-010 - ENSP00000457696 [100%]
CLK3-013 - ENSP00000455762 [100%]
CLK3-015 - ENSP00000458099 [100%]
CLK3-202 - ENSP00000323106 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:66 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

73.5, 58.6, 56.2, 36.4, 28.9, 27.0 

Antibody dilution

1:330 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CLK3-001
 
CLK3-003
 
CLK3-010
 
CLK3-013
 
CLK3-015
 
CLK3-202