CAPN12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043492

 

Antibody HPA053322

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043492 HPA053322 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

63 87 

Antigen sequence

DGEFWMELRDFLLHFDTVQICSLSPEVLGPSPEGGGWHVHTFQGRWVRGF
NSGGSQPNAETFW
 
GDEADFTLRVFSERRHTAVEIDDVISADLQSLQGPYLPLELGLEQLFQEL
AGEEEELNASQLQALLSIALEPARAHTSTPREIGLRT
 

Matching transcripts

CAPN12-001 - ENSP00000331636 [100%]
CAPN12-002 - ENSP00000473156 [100%]
 CAPN12-001 - ENSP00000331636 [100%]
CAPN12-002 - ENSP00000473156 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows strong positivity in hepatocytes.
More information
 Immunohistochemical staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:65 1:150 

Literature conformity

No avaliable gene/protein characterization data No avaliable gene/protein characterization data 

RNA consistency

Not consistent with RNA expression data Not consistent with RNA expression data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

81.0, 64.5 81.0, 64.5 

Antibody dilution

1:250 1:100 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:850 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CAPN12-001
 
CAPN12-002