MAGEB17

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003756

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003756 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

123 

Antigen sequence

LYLKEMDPSRQSYVLVGKLDFPNQGSLSDGGGFPLSGLLMVLLSTIFMHG
NRATEEEMWECLNALGMYKGRKHFIYGEPQELVTKDLVREGYLEYQQVPS
SDPPRYEFLWGPRARAETSKMKV
 

Matching transcripts

MAGEB17-001 - ENSP00000382883 [100%]
MAGEB17-002 - ENSP00000382884 [100%]
MAGEB17-201 - ENSP00000328274 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocyte.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

No avaliable characterization data 

RNA consistency

Not at all consistent with RNAseq data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

37.6, 37.0 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MAGEB17-001
 
MAGEB17-002
 
MAGEB17-201