AFMID

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023861

 

Antibody HPA026536

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023861 HPA026536 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

67 65 

Antigen sequence

VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEAT
TRARATRKSLLHVPYGD
 
LPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHM
VDQVTRSVAFVQKRY
 

Matching transcripts

AFMID-001 - ENSP00000328938 [100%]
AFMID-005 - ENSP00000386890 [100%]
AFMID-006 - ENSP00000466515 [100%]
AFMID-007 - ENSP00000466566 [100%]
AFMID-010 - ENSP00000465406 [100%]
 AFMID-001 - ENSP00000328938 [100%]
AFMID-005 - ENSP00000386890 [100%]
AFMID-006 - ENSP00000466515 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 Immunohistochemical staining of human kidney shows distinct cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:300 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423254)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423254)
More information
 

Target mass (kDa)

34.5, 34.0, 22.7, 20.6, 12.6 34.5, 34.0, 22.7 

Antibody dilution

1:125 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AFMID-001
 
AFMID-005
 
AFMID-006
 
AFMID-007
 
AFMID-010