SFXN4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018028

 

Antibody HPA020872

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018028 HPA020872 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

131 62 

Antigen sequence

LEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELLDP
TNVFISVESIENSRQLLCTNEDVSSPASADQRIQEAWKRSLATVHPDSSN
LIPKLFRPAAFLPFMAPTVFLSMTPLKGIKS
 
KYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGH
SRIAGTKAVRET
 

Matching transcripts

SFXN4-001 - ENSP00000347924 [100%]
SFXN4-201 - ENSP00000333200 [93%]
 SFXN4-001 - ENSP00000347924 [100%]
SFXN4-004 - ENSP00000358127 [100%]
SFXN4-201 - ENSP00000333200 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity of parietal cells in the gastric mucosa.
More information
 Immunohistochemical staining of human heart muscle shows strong positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 

Antibody dilution

1:65 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403878)
More information
  

Target mass (kDa)

38.0, 36.9 38.0, 36.9, 19.7 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SFXN4-001
 
SFXN4-004
 
SFXN4-201