KIRREL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030458

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030458 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

142 

Antigen sequence

VTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYET
NVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSD
VTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADA
 

Matching transcripts

KIRREL-001 - ENSP00000352138 [100%]
KIRREL-002 - ENSP00000353202 [100%]
KIRREL-202 - ENSP00000376098 [100%]
KIRREL-203 - ENSP00000389674 [100%]
KIRREL-003 - ENSP00000357154 [90%]
KIRREL-201 - ENSP00000357155 [90%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows cytoplasmic positivity in podocytes in glomeruli.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:60 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.0, 83.5, 72.7, 72.4, 65.7, 63.1 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KIRREL-001
 
KIRREL-002
 
KIRREL-003
 
KIRREL-201
 
KIRREL-202
 
KIRREL-203