IRAK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA054476

 

Antibody CAB004461

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA054476 sc-5288 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

91  

Antigen sequence

GAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSG
QRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHP
 
 

Matching transcripts

IRAK1-001 - ENSP00000358991 [100%]
IRAK1-002 - ENSP00000377291 [100%]
IRAK1-012 - ENSP00000358997 [100%]
IRAK1-017 - ENSP00000399974 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glands.
More information
 Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:25 

Literature conformity

Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.5, 73.4, 68.0, 25.3 76.5, 76.1, 74.6, 73.4, 68.0, 42.1, 37.0, 28.9, 25.3, 23.5, 22.6 

Antibody dilution

1:330 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus & cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:66  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
IRAK1-001
 
IRAK1-002
 
IRAK1-012
 
IRAK1-017