KCNQ5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016655

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016655 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

116 

Antigen sequence

LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGL
QFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINT
APKPAAPTTLQIPPPL
 

Matching transcripts

KCNQ5-001 - ENSP00000359425 [100%]
KCNQ5-006 - ENSP00000345055 [100%]
KCNQ5-201 - ENSP00000347326 [100%]
KCNQ5-202 - ENSP00000347853 [100%]
KCNQ5-203 - ENSP00000385501 [100%]
KCNQ5-204 - ENSP00000384453 [100%]
KCNQ5-205 - ENSP00000409861 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 

Antibody dilution

1:45 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

104.5, 103.6, 102.4, 102.2, 101.3, 90.0 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KCNQ5-001
 
KCNQ5-006
 
KCNQ5-201
 
KCNQ5-202
 
KCNQ5-203
 
KCNQ5-204
 
KCNQ5-205