BCAP31

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003906

 

Antibody CAB015350

 

Antibody CAB015424

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Santa Cruz Biotechnology
 

Product name

HPA003906 sc-48766 sc-56008 

Host species

Rabbit Rabbit Rat 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

2 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Not known 

Length (aa)

100   

Antigen sequence

ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQK
LKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
 
 
 

Matching transcripts

BCAP31-001 - ENSP00000343458 [100%]
BCAP31-002 - ENSP00000392330 [100%]
BCAP31-201 - ENSP00000405417 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:6000 1:800 1:35 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in endoplasmic reticulum.
More information
 Application not done for this antibody. 

Antibody dilution

1:200 1:200  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

34.8, 28.0 34.8, 28.0, 21.3, 21.2, 20.7, 20.2, 16.0 34.8, 28.0, 21.3, 21.2, 20.7, 20.2, 16.0 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
BCAP31-001
 
BCAP31-002
 
BCAP31-201