FNBP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019691

 

Antibody HPA022119

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019691 HPA022119 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

107 83 

Antigen sequence

KARQQAQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEME
ERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIE
AYKSGFE
 
RQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFD
DEEPLPAIGTCKALYTFEGQNEGTISVVEGETL
 

Matching transcripts

FNBP1-002 - ENSP00000413625 [100%]
FNBP1-003 - ENSP00000347907 [100%]
FNBP1-004 - ENSP00000415602 [100%]
FNBP1-201 - ENSP00000407548 [100%]
 FNBP1-002 - ENSP00000413625 [100%]
FNBP1-003 - ENSP00000347907 [100%]
FNBP1-004 - ENSP00000415602 [100%]
FNBP1-201 - ENSP00000407548 [100%]
FNBP1-202 - ENSP00000389117 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human spleen shows distinct cytoplasmic positivity in the white pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:150 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in nucleoli & cytoplasm.
More information
 

Antibody dilution

1:133 1:20 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

71.3, 70.3, 68.9, 65.2 71.3, 70.3, 68.9, 65.2, 28.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FNBP1-002
 
FNBP1-003
 
FNBP1-004
 
FNBP1-201
 
FNBP1-202