USP7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015641

 

Antibody CAB008108

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Rockland
 

Product name

HPA015641 600-401-498 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

143  

Antigen sequence

RSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSV
GFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDW
GFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSK
 
 

Matching transcripts

USP7-001 - ENSP00000343535 [100%]
USP7-003 - ENSP00000439272 [100%]
USP7-004 - ENSP00000371310 [100%]
USP7-010 - ENSP00000456150 [86%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows distinct nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:5 1:250 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

128.3, 126.3, 58.6, 15.4 128.3, 126.3, 117.0, 105.5, 58.6, 18.4, 15.4, 14.1, 13.0, 10.4, 7.9, 5.0, 1.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line Hep G2 shows positivity in the Golgi apparatus.
More information
 Application not done for this antibody. 

Antibody dilution

1:10  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
USP7-001
 
USP7-003
 
USP7-004
 
USP7-010