SERPINA5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA056919

 

Antibody HPA061957

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA056919 HPA061957 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

57 57 

Antigen sequence

DLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQR
LVFNRPF
 
KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGV
PYQGNAT
 

Matching transcripts

SERPINA5-002 - ENSP00000450837 [100%]
SERPINA5-003 - ENSP00000451126 [100%]
SERPINA5-008 - ENSP00000451610 [100%]
SERPINA5-201 - ENSP00000333203 [100%]
 SERPINA5-002 - ENSP00000450837 [100%]
SERPINA5-003 - ENSP00000451126 [100%]
SERPINA5-008 - ENSP00000451610 [100%]
SERPINA5-012 - ENSP00000452469 [100%]
SERPINA5-201 - ENSP00000333203 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity (granular pattern) in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:1500 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line CACO-2 shows positivity in mitochondria.
More information
 Application not done for this antibody. 

Antibody dilution

1:4  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.7 45.7, 34.1 

Antibody dilution

1:80 1:280 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3400 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SERPINA5-002
 
SERPINA5-003
 
SERPINA5-008
 
SERPINA5-012
 
SERPINA5-201