DAPK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040472

 

Antibody HPA048436

 

Antibody CAB037302

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA040472 HPA048436 D1319 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 13 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

137 144  

Antigen sequence

QNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVFSLEEPYEI
QLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPA
GGEFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGA
 
HKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIE
VQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREH
HEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHD
 
 

Matching transcripts

DAPK1-001 - ENSP00000350785 [100%]
DAPK1-008 - ENSP00000417076 [100%]
DAPK1-010 - ENSP00000386135 [100%]
DAPK1-201 - ENSP00000418885 [100%]
 DAPK1-001 - ENSP00000350785 [100%]
DAPK1-008 - ENSP00000417076 [100%]
DAPK1-010 - ENSP00000386135 [100%]
DAPK1-011 - ENSP00000419026 [100%]
DAPK1-201 - ENSP00000418885 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human vulva/anal skin shows distinct cytoplasmic positivity in basal layer of epidermis.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:50 1:3000 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in centrosome.
More information
 

Antibody dilution

  1:2000 

Validation IF

  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

162.8, 160.0 162.8, 160.0, 152.5 162.8, 160.0, 152.5, 21.6 

Antibody dilution

1:250 1:150 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:1200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
DAPK1-001
 
DAPK1-008
 
DAPK1-010
 
DAPK1-011
 
DAPK1-201