NPIPB9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011188

 

Antibody HPA026924

 

Antibody HPA053611

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA011188 HPA026924 HPA053611 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

43 68 26 

Antigen sequence

EQSPKPKRQREAEAQQLPKPKRRRLSKLRTRHCTQAWAIRINP
 
PVSFLKTIFWSRNGHDGSMDVQQRAWRSNRSRQKGLRSICMHTKKRVSSF
RGNKIGLKDVITLRRHVE
 
NRMGHQPPPPTQQHSIIDNSLSLKTP
 

Matching transcripts

NPIPB9-001 - ENSP00000446902 [100%]
NPIPB9-002 - ENSP00000350444 [100%]
NPIPB9-201 - ENSP00000415207 [100%]
 NPIPB9-201 - ENSP00000415207 [100%]
NPIPB9-001 - ENSP00000446902 [99%]
 NPIPB9-001 - ENSP00000446902 [92%]
NPIPB9-002 - ENSP00000350444 [92%]
NPIPB9-201 - ENSP00000415207 [92%]
 

Other gene match

NPIPB15 - ENSG00000196436 [100%]
CTB-134H23.2 - ENSG00000196796 [100%]
NPIPB6 - ENSG00000198156 [100%]
NPIPB7 - ENSG00000233232 [100%]
NPIPB8 - ENSG00000255524 [100%]
 RP11-231C14.4 - ENSG00000169203 [93%]
NPIPB3 - ENSG00000169246 [93%]
NPIPB4 - ENSG00000185864 [91%]
NPIPB15 - ENSG00000196436 [97%]
CTB-134H23.2 - ENSG00000196796 [96%]
RP11-347C12.1 - ENSG00000198064 [93%]
NPIPB6 - ENSG00000198156 [99%]
NPIPB7 - ENSG00000233232 [99%]
RP11-166B2.1 - ENSG00000234719 [85%]
NPIPB5 - ENSG00000243716 [93%]
NPIPB11 - ENSG00000254206 [93%]
NPIPB8 - ENSG00000255524 [99%]
 RP11-231C14.4 - ENSG00000169203 [96%]
NPIPB3 - ENSG00000169246 [96%]
NPIPA1 - ENSG00000183426 [100%]
NPIPA5 - ENSG00000183793 [100%]
AC138969.4 - ENSG00000183889 [100%]
NPIPB4 - ENSG00000185864 [96%]
NPIPB15 - ENSG00000196436 [92%]
CTB-134H23.2 - ENSG00000196796 [92%]
RP11-347C12.1 - ENSG00000198064 [96%]
NPIPB6 - ENSG00000198156 [92%]
NPIPA8 - ENSG00000214940 [100%]
NPIPA7 - ENSG00000214967 [100%]
NPIPA3 - ENSG00000224712 [100%]
RP11-419C5.2 - ENSG00000226232 [92%]
RP11-1212A22.4 - ENSG00000233024 [100%]
NPIPB7 - ENSG00000233232 [92%]
RP11-166B2.1 - ENSG00000234719 [96%]
NPIPB5 - ENSG00000243716 [96%]
NPIPB11 - ENSG00000254206 [92%]
NPIPA2 - ENSG00000254852 [100%]
NPIPB8 - ENSG00000255524 [92%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in cells outside the germinal center.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:125 1:20 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
   

Antibody dilution

1:22   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.3, 49.8, 49.6, 49.2, 47.7, 47.2, 40.9, 36.2 129.2, 126.7, 126.5, 126.0, 95.9, 95.8, 67.1, 65.9, 51.3, 49.8, 49.6, 49.2, 47.7, 47.2, 45.6, 40.9, 40.6, 29.3, 19.1, 17.3 129.2, 126.7, 126.5, 126.0, 108.7, 107.7, 95.9, 95.8, 83.7, 67.1, 65.9, 51.3, 49.8, 49.6, 49.2, 47.7, 47.2, 45.8, 45.6, 42.3, 42.2, 42.1, 40.9, 40.6, 40.1, 40.0, 38.1, 36.2, 35.3, 16.7 

Antibody dilution

1:250 1:250 1:220 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 1:1750 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NPIPB9-001
 
NPIPB9-002
 
NPIPB9-201