ZNF420

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA053022

 

Antibody HPA059675

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA053022 HPA059675 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

66 67 

Antigen sequence

NLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESNSRDYL
EAKGKMEKQQENQKEY
 
TAFLAGQQDRSDIYMSRRFTKSIFPVFFSVPTMWTSKLELRYSHGDFENG
IWVLWIMEQKYRRSLQP
 

Matching transcripts

ZNF420-001 - ENSP00000338770 [100%]
ZNF420-002 - ENSP00000306102 [100%]
ZNF420-005 - ENSP00000467772 [100%]
 ZNF420-002 - ENSP00000306102 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in parietal cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:350  

Literature conformity

No avaliable characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

80.2, 63.0, 19.4 63.0 

Antibody dilution

1:430 1:80 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3450 1:550 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:20 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
ZNF420-001
 
ZNF420-002
 
ZNF420-005