SYNGAP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038373

 

Antibody HPA038374

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038373 HPA038374 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

83 75 

Antigen sequence

LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGS
GGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
 
QGSGSSITAAGMRLSQMGVTTDGVPAQQLRIPLSFQNPLFHMAADGPGPP
GGHGGGGGHGPPSSHHHHHHHHHHR
 

Matching transcripts

SYNGAP1-001 - ENSP00000403636 [100%]
SYNGAP1-003 - ENSP00000412475 [100%]
SYNGAP1-009 - ENSP00000416519 [100%]
SYNGAP1-201 - ENSP00000293748 [100%]
 SYNGAP1-001 - ENSP00000403636 [100%]
SYNGAP1-003 - ENSP00000412475 [100%]
SYNGAP1-009 - ENSP00000416519 [100%]
SYNGAP1-201 - ENSP00000293748 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:35 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
More information
 Application not done for this antibody. 

Antibody dilution

1:27  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

148.3, 143.6, 141.3, 140.9 148.3, 143.6, 141.3, 140.9 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SYNGAP1-001
 
SYNGAP1-003
 
SYNGAP1-009
 
SYNGAP1-201