PIGN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039922

 

Antibody HPA040374

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039922 HPA040374 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

96 83 

Antigen sequence

SWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSLFNESK
YTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTW
 
KVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTP
LVTWGAGIKYPQRVSAQQFDDAFLKEWRLENWK
 

Matching transcripts

PIGN-001 - ENSP00000350263 [100%]
PIGN-004 - ENSP00000383188 [100%]
PIGN-005 - ENSP00000468721 [100%]
PIGN-007 - ENSP00000467812 [100%]
PIGN-013 - ENSP00000466462 [100%]
PIGN-014 - ENSP00000467458 [100%]
PIGN-009 - ENSP00000464707 [99%]
PIGN-015 - ENSP00000467618 [85%]
PIGN-012 - ENSP00000466883 [83%]
 PIGN-001 - ENSP00000350263 [100%]
PIGN-004 - ENSP00000383188 [100%]
PIGN-019 - ENSP00000466373 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:300 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:200 1:91 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406118)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406118)
More information
 

Target mass (kDa)

105.8, 21.8, 21.4, 20.9, 15.7, 13.9, 11.7, 9.4 105.8, 29.3 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:30000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
PIGN-001
 
PIGN-004
 
PIGN-005
 
PIGN-007
 
PIGN-009
 
PIGN-012
 
PIGN-013
 
PIGN-014
 
PIGN-015
 
PIGN-019