IRAK4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000924

 

Antibody CAB016685

 

Antibody CAB022077

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 Upstate
 

Product name

HPA000924 LF-PA0173 07-418  

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

2 4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

137   

Antigen sequence

SPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPS
KEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTR
FHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVY
 
 
 

Matching transcripts

IRAK4-001 - ENSP00000390651 [100%]
IRAK4-002 - ENSP00000446490 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells and smooth muscle cells.
More information
 Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:200 1:75 1:75 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402503)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.5 51.5, 37.7, 10.1, 6.9, 6.3 51.5, 37.7, 10.1, 6.9, 6.3 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:4000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & cytoskeleton (microtubules).
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & cytoskeleton (microtubules).
More information
 

Antibody dilution

 1:19 1:19 

Validation IF

 Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
IRAK4-001
 
IRAK4-002