AVPR1B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017337

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA017337 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

37 

Antigen sequence

MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVE
 

Matching transcripts

AVPR1B-001 - ENSP00000356094 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows distinct cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

No internal RNA expression data available for correlation 

         Western Blot

Image

 

Description

 

Target mass (kDa)

47.0 

Antibody dilution

1:250 

Validation WB

Current setup is not applicable due to low RNA count 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AVPR1B-001