ASNA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045951

 

Antibody HPA048087

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045951 HPA048087 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

96 84 

Antigen sequence

CIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCEARHK
IQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYK
 
EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTD
PAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS
 

Matching transcripts

ASNA1-001 - ENSP00000466379 [100%]
ASNA1-201 - ENSP00000349887 [100%]
 ASNA1-001 - ENSP00000466379 [100%]
ASNA1-002 - ENSP00000468450 [100%]
ASNA1-201 - ENSP00000349887 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:100  

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

38.8 38.8, 21.9 

Antibody dilution

1:250 1:80 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus & nucleoli.
More information
 

Antibody dilution

 1:4 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
ASNA1-001
 
ASNA1-002
 
ASNA1-201