STKLD1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029902

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029902 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

101 

Antigen sequence

CQDRALLVNNAYRGLASLVKVSELAAFKVVVQEEGGSGLSLIKETYQLHR
DDPEVVENVGMLLVHLASYEEILPELVSSSMKALLQEIKERFTSSLVSDS
S
 

Matching transcripts

STKLD1-001 - ENSP00000361025 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity with granular pattern in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:125 

Literature conformity

No avaliable gene/protein characterization data 

RNA consistency

Not consistent with RNA expression data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

75.7 

Antibody dilution

1:250 

Validation WB

Current setup is not applicable due to low RNA count 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
STKLD1-001